Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
C1orf216 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$208.00 - $487.50
Specifications
| Antigen | C1orf216 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP16916520
|
Novus Biologicals
NBP16916520UL |
20 μL |
Each for $208.00
|
|
|||||
|
NBP169165
|
Novus Biologicals
NBP169165 |
100 μL |
Each for $487.50
|
|
|||||
Description
C1orf216 Polyclonal specifically detects C1orf216 in Human samples. It is validated for Western Blot.Specifications
| C1orf216 | |
| Polyclonal | |
| Rabbit | |
| Q8TAB5 | |
| 127703 | |
| Synthetic peptides corresponding to C1orf216 (chromosome 1 open reading frame 216) The peptide sequence was selected from the N terminal of C1orf216. Peptide sequence GRVEPILRRSSSESPSDNQAFQAPGSPEEGVRSPPEGAEIPGAEPEKMGG. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| chromosome 1 open reading frame 216, FLJ38984, hypothetical protein LOC127703 | |
| C1ORF216 | |
| IgG | |
| 25 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title