C9orf72 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP193504

Catalog No. NBP193504

Description

C9orf72 Polyclonal antibody specifically detects C9orf72 in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin).

Specifications

• Antigen: C9orf72
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: ALSFTD, chromosome 9 open reading frame 72, FTDALS
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 203228
• Target Species: Human, Rat
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Concentration: 0.2mg/mL
• Dilution: Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: Q96LT7
• Gene Symbols: C9orf72
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:YGLSIILPQTELSFYLPLHRVCVDRLTHIIRKGRIWMHKERQENVQKIILEGTERMEDQGQSIIPMLTGEVIPVMELLSSMKSHSVPEEI
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only