Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Carbonic Anhydrase VII/CA7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | Carbonic Anhydrase VII/CA7 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Carbonic Anhydrase VII/CA7 Polyclonal specifically detects Carbonic Anhydrase VII/CA7 in Human samples. It is validated for Western Blot.Specifications
Carbonic Anhydrase VII/CA7 | |
Polyclonal | |
Rabbit | |
Lipid and Metabolism | |
Carbonate dehydratase VII, carbonic anhydrase 7, carbonic anhydrase VIICAVII, carbonic dehydratase VII, CA-VII, EC 4.2.1.1 | |
CA7 | |
IgG | |
23 kDa |
Western Blot | |
Unconjugated | |
RUO | |
Q86YU0 | |
766 | |
Synthetic peptides corresponding to CA7 (carbonic anhydrase VII) The peptide sequence was selected from the C terminal of CA7. Peptide sequence SLTTPPLSESVTWIVLREPICISERQMGKFRSLLFTSEDDERIHMVNNFR. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title