Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Carboxylesterase 3/CES3/Esterase 31 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00
Specifications
| Antigen | Carboxylesterase 3/CES3/Esterase 31 |
|---|---|
| Dilution | Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
Carboxylesterase 3/CES3/Esterase 31 Polyclonal antibody specifically detects Carboxylesterase 3/CES3/Esterase 31 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| Carboxylesterase 3/CES3/Esterase 31 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Human | |
| carboxylesterase 3, carboxylesterase 3 (brain), EC 3.1.1, EC 3.1.1.1, ES31FLJ21736, esterase 31, Liver carboxylesterase 31 homolog | |
| This antibody was developed against a recombinant protein corresponding to amino acids: PVLTSLDVPPEMMPTVIDEYLGSNSDAQAKCQAFQEFMGDVFINVPTVSFSRYLRDSGSPVFFYEFQHRPSSF | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.2), 40% Glycerol | |
| 23491 | |
| IgG | |
| Immunogen affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title