CCL19/MIP-3 beta Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NBP256275	Novus Biologicals NBP256275	100 μL
NB403749	Novus Biologicals NBP25627525UL	25 μL

Description

CCL19/MIP-3 beta Polyclonal specifically detects CCL19/MIP-3 beta in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CCL19/MIP-3 beta
• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 6363
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Alias: beta chemokine exodus-3, Beta-chemokine exodus-3, CC chemokine ligand 19, C-C motif chemokine 19, chemokine (C-C motif) ligand 19, CKb11, EBI1-ligand chemokine, ELCMIP-3-beta, Epstein-Barr virus-induced molecule 1 ligand chemokine, exodus-3, Macrophage inflammatory protein 3 beta, macrophage inflammatory protein 3-beta, MGC34433, MIP-3b, MIP3BCK beta-11, SCYA19EBI1 ligand chemokine, small inducible cytokine subfamily A (Cys-Cys), member 19, Small-inducible cytokine A19
• Gene Symbols: CCL19
• Isotype: IgG
• Purification Method: Affinity Purified

For Research Use Only