Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CCNB3 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen CCNB3
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Form Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP1802720
View Documents
Novus Biologicals
NBP18012720UL
20 μL
Each for $152.22
Add to cart
 
NBP180127
View Documents
Novus Biologicals
NBP180127
100 μL
Each for $436.00
Add to cart
 
Description

Description

CCNB3 Polyclonal specifically detects CCNB3 in Human samples. It is validated for Western Blot.
Specifications

Specifications

CCNB3
Polyclonal
Purified
RUO
PBS and 2% Sucrose with 0.09% Sodium Azide
CYCB3, cyclin B3, G2/mitotic-specific cyclin-B3
CCNB3
IgG
Protein A purified
291 kDa
Western Blot
Unconjugated
Rabbit
Cell Cycle and Replication
NP_391990
85417
Synthetic peptide directed towards the N terminal of human CCNB3. Peptide sequence: MLLPLPPQSSKPVPKKSQSSKIVPSHHDPSEKTGENCQTKISPSSLQESP
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit