Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CCNB3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | CCNB3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP1802720
|
Novus Biologicals
NBP18012720UL |
20 μL |
Each for $152.22
|
|
NBP180127
|
Novus Biologicals
NBP180127 |
100 μL |
Each for $436.00
|
|
Description
CCNB3 Polyclonal specifically detects CCNB3 in Human samples. It is validated for Western Blot.Specifications
| CCNB3 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| CYCB3, cyclin B3, G2/mitotic-specific cyclin-B3 | |
| CCNB3 | |
| IgG | |
| Protein A purified | |
| 291 kDa |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cell Cycle and Replication | |
| NP_391990 | |
| 85417 | |
| Synthetic peptide directed towards the N terminal of human CCNB3. Peptide sequence: MLLPLPPQSSKPVPKKSQSSKIVPSHHDPSEKTGENCQTKISPSSLQESP | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title