Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CCT8 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | CCT8 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15660820
|
Novus Biologicals
NBP15660820UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP156608
|
Novus Biologicals
NBP156608 |
100 μL |
Each for $487.50
|
|
|||||
Description
CCT8 Polyclonal specifically detects CCT8 in Human, Mouse samples. It is validated for Western Blot.Specifications
| CCT8 | |
| Polyclonal | |
| Rabbit | |
| C21orf112, CCTQ, CCT-theta, chaperonin containing TCP1, subunit 8 (theta), chromosome 21 open reading frame 112, D21S246, KIAA0002, PRED71, T-complex protein 1 subunit theta, T-complex protein 1, theta subunit, 10Renal carcinoma antigen NY-REN-15, TCP-1-theta | |
| CCT8 | |
| IgG | |
| This product is specific to Subunit or Isoform: theta. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 10694 | |
| Synthetic peptides corresponding to CCT8(chaperonin containing TCP1, subunit 8 (theta)) The peptide sequence was selected from the C terminal of CCT8. Peptide sequence DMLEAGILDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAGGPKPPSGKK. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title