Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CD155/PVR Antibody, Novus Biologicals™
SDP

Catalog No. NB239004 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB239004 25 μg
NB238771 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB239004 Supplier Novus Biologicals Supplier No. NBP32130425UL
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

CD155/PVR Polyclonal antibody specifically detects CD155/PVR in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

Antigen CD155/PVR
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias CD155, CD155 antigen, HVED, NECL5, NECL-5, nectin-like 5, Nectin-like protein 5, poliovirus receptor, PVSFLJ25946, Tage4
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: QGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILV
Purification Method Affinity purified
Quantity 25 μg
Regulatory Status RUO
Research Discipline Virology Bacteria and Parasites
Primary or Secondary Primary
Gene ID (Entrez) 5817
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.