Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CD3 gamma Antibody, Novus Biologicals™
SDP

Catalog No. NBP232636 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP232636 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP232636 Supplier Novus Biologicals Supplier No. NBP232636
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

CD3 gamma Polyclonal specifically detects CD3 gamma in Human samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen CD3 gamma
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 ug/ml, Simple Western 1:25, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias CD3g antigen, CD3g antigen, gamma polypeptide (TiT3 complex), CD3g molecule, epsilon (CD3-TCR complex), CD3g molecule, gamma (CD3-TCR complex), CD3-GAMMA, FLJ17620, FLJ17664, FLJ79544, FLJ94613, MGC138597, T3G, T-cell antigen receptor complex, gamma subunit of T3, T-cell receptor T3 gamma chain, T-cell surface glycoprotein CD3 gamma chain
Gene Symbols CD3G
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: GQDGVRQSRASDKQTLLPNDQLYQPLKDREDDQYSHLQGNQLRRN
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Apoptosis, Innate Immunity
Primary or Secondary Primary
Gene ID (Entrez) 917
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.