Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. CDC73/HRPT2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

CDC73/HRPT2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
SDP

Catalog No. NB159664 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB159664 100 μg
NB159665 25 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Catalog No. NB159664 Supplier Novus Biologicals Supplier No. NBP317817100UL
Only null left
Add to Cart
Add to Cart
This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

CDC73/HRPT2 Polyclonal antibody specifically detects CDC73/HRPT2 in Human samples. It is validated for Immunofluorescence

Specifications

Antigen CDC73/HRPT2
Applications Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias C1orf28hyperparathyroidism 2 (with jaw tumor), cell division cycle 73, Paf1/RNA polymerase II complex component, homolog (S.cerevisiae), Cell division cycle protein 73 homolog, chromosome 1 open reading frame 28, HPTJT, HRPT2FLJ23316, Hyperparathyroidism 2 protein, HYX, parafibromin
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: WDRVVAVFVQGPAWQFKGWPWLLPDGSPVDIFAKIKAFHLKYDEVRLDPNVQKWDVTVLELSYHKRHLDRPVFLRFWETLDRYMVKHKSHL
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Cancer, Tumor Suppressors
Primary or Secondary Primary
Gene ID (Entrez) 79577
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.