Ceramide Kinase Like Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP168988

Catalog No. NBP168988

Description

Ceramide Kinase Like Polyclonal specifically detects Ceramide Kinase Like in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Ceramide Kinase Like
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: CERKL
• Immunogen: Synthetic peptides corresponding to CERKL (ceramide kinase-like) The peptide sequence was selected from the C terminal of CERKL. Peptide sequence ASVKNQFNFPFVETYTVEEVKVHPRNNTGGYNPEEEEDETASENCFPWNV.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Yeast: 89%; Porcine: 79%; Rat: 79%; Equine: 79%; Mouse: 79%; Zebrafish: 79%; Guinea pig: 79%.
• Target Species: Human, Mouse, Rat, Canine, Equine, Guinea Pig, Rabbit, Yeast, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: ceramide kinase-like, ceramide kinase-like protein, retinitis pigmentosa 26 (autosomal recessive), RP26
• Host Species: Rabbit
• Molecular Weight of Antigen: 51 kDa
• Quantity: 100 μL
• Research Discipline: Vision
• Gene ID (Entrez): 375298
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.