Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Ceramide Kinase Like Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | Ceramide Kinase Like |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Ceramide Kinase Like Polyclonal specifically detects Ceramide Kinase Like in Human samples. It is validated for Western Blot.Specifications
Ceramide Kinase Like | |
Polyclonal | |
Rabbit | |
Vision | |
375298 | |
Synthetic peptides corresponding to CERKL (ceramide kinase-like) The peptide sequence was selected from the C terminal of CERKL. Peptide sequence ASVKNQFNFPFVETYTVEEVKVHPRNNTGGYNPEEEEDETASENCFPWNV. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
ceramide kinase-like, ceramide kinase-like protein, retinitis pigmentosa 26 (autosomal recessive), RP26 | |
CERKL | |
IgG | |
51 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title