Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CGR19 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$487.50

Specifications

Antigen	CGR19
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP155026 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP155026	100 μL	Each of 1 for $487.50	Only null left	Sign In or Register to check your price. Add to Cart

Description

CGR19 Polyclonal specifically detects CGR19 in Human samples. It is validated for Western Blot.

Specifications

Antigen	CGR19
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	Cell Cycle and Replication
Gene Alias	cell growth regulator with ring finger domain 1, Cell growth regulatory gene 19 protein, CGR19cell growth regulator with RING finger domain protein 1, RING finger protein 197, RNF197GCRRF1
Gene Symbols	CGRRF1
Isotype	IgG
Molecular Weight of Antigen	38 kDa

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Accession No.	Q99675
Gene ID (Entrez)	10668
Immunogen	Synthetic peptides corresponding to CGRRF1(cell growth regulator with ring finger domain 1) The peptide sequence was selected from the middle region of CGRRF1. Peptide sequence KKDSKEEIYCQLPRDTKIEDFGTVPRSRYPLVALLTLADEDDREIYDIIS.
Primary or Secondary	Primary

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

CGR19 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents