Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CHST11 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | CHST11 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP1689220
|
Novus Biologicals
NBP16891220UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP168912
|
Novus Biologicals
NBP168912 |
100 μL |
Each for $487.50
|
|
|||||
Description
CHST11 Polyclonal specifically detects CHST11 in Rat samples. It is validated for Western Blot.Specifications
| CHST11 | |
| Polyclonal | |
| Rabbit | |
| P69478 | |
| 50515 | |
| Synthetic peptides corresponding to Chst11 (carbohydrate (chondroitin 4) sulfotransferase 11) The peptide sequence was selected from the C terminal of Chst11. Peptide sequence FEEFVAYLIDPHTQREEPFNEHWQTVYSLCHPCHIHYDLVGKYETLEEDS. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| C4S-1, C4ST, C4St-1, C4ST1EC 2.8.2.5, carbohydrate (chondroitin 4) sulfotransferase 11, carbohydrate sulfotransferase 11, Chondroitin 4-O-sulfotransferase 1, Chondroitin 4-sulfotransferase 1, DKFZp667A035, FLJ41682, HSA269537, IgH/CHST11 fusion | |
| CHST11 | |
| IgG | |
| 38 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title