Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CLDND1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | CLDND1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
CLDND1 Polyclonal specifically detects CLDND1 in Human samples. It is validated for Western Blot.Specifications
CLDND1 | |
Polyclonal | |
Rabbit | |
Q9NY35 | |
56650 | |
Synthetic peptides corresponding to CLDND1(claudin domain containing 1) The peptide sequence was selected from the middle region of CLDND1. Peptide sequence TLTEQFMEKFVDPGNHNSGIDLLRTYLWRCQFLLPFVSLGLMCFGALIGL. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
C3orf4, chromosome 3 open reading frame 4, claudin domain containing 1, claudin domain containing 1 protein, claudin domain-containing protein 1, GENX-3745, Membrane protein GENX-3745, MGC111162, MGC3316, MGC9861 | |
CLDND1 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title