Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Coagulation Factor XI Antibody, Novus Biologicals™
SDP

Catalog No. NBP17423420 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP17423420 20 μL
NBP174234 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP17423420 Supplier Novus Biologicals Supplier No. NBP17423420UL
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

Coagulation Factor XI Polyclonal specifically detects Coagulation Factor XI in Human samples. It is validated for Western Blot.

Specifications

Antigen Coagulation Factor XI
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P03951
Gene Alias coagulation factor XI, EC 3.4.21, EC 3.4.21.27, FXIPlasma thromboplastin antecedent, MGC141891, PTA
Gene Symbols F11
Host Species Rabbit
Immunogen Synthetic peptides corresponding to the C terminal of F11. Immunizing peptide sequence RHLCGGSIIGNQWILTAAHCFYGVESPKILRVYSGILNQSEIKEDTSFFG.
Molecular Weight of Antigen 70 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Prostate Cancer
Primary or Secondary Primary
Gene ID (Entrez) 2160
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.