Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Collagen VI alpha 1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP159126 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP159126 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP159126 Supplier Novus Biologicals Supplier No. NBP159126

Item Discontinued This item has been discontinued by the supplier. Please to view product availability in your area.

Rabbit Polyclonal Antibody has been used in 2 publications

Collagen VI alpha 1 Polyclonal specifically detects Collagen VI alpha 1 in Human samples. It is validated for Western Blot.

Specifications

Antigen Collagen VI
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P12109
Gene Alias Collagen 6, collagen alpha-1(VI) chain, collagen VI, alpha-1 polypeptide, collagen, type VI, alpha 1, Collagen-6, human mRNA for collagen VI alpha-1 C-terminal globular domain10alpha 1 (VI) chain (61 AA), OPLL
Gene Symbols COL6A1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to COL6A1(collagen, type VI, alpha 1) The peptide sequence was selected from the middle region of COL6A1 (NP_001839). Peptide sequence ADITILLDGSASVGSHNFDTTKRFAKRLAERFLTAGRTDPAHDVRVAVVQ.
Molecular Weight of Antigen 108 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Cytoskeleton Markers, Extracellular Matrix
Primary or Secondary Primary
Gene ID (Entrez) 1291
Test Specificity Expected identity based on immunogen sequence: Canine: 100%; Human: 100%; Pig: 100%; Rabbit: 100%; Bovine: 92%; Equine: 92%; Mouse: 85%; Rat: 85%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Rabbit
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.