Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Collagen XXI Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | Collagen XXI |
---|---|
Concentration | 0.05mg/mL |
Dilution | Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml |
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Description
Collagen XXI Polyclonal specifically detects Collagen XXI in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
Collagen XXI | |
Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml | |
Polyclonal | |
Rabbit | |
Cytoskeleton Markers, Extracellular Matrix | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
alpha 1 chain-like collagen, alpha 1 type XXI collagen, COL1AL, COLA1L, Collagen 21, collagen alpha-1(XXI) chain, collagen, type XXI, alpha 1, Collagen-21, dJ682J15.1, dJ708F5.1, DKFZp564B052, FLJ39125, FLJ44623, MGC26619 | |
COL21A1 | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
0.05mg/mL | |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
Human | |
Q96P44 | |
81578 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:AKSSRFLTKIAVVLTDGKSQDDVKDAAQAARDSKITLFAIGVGSETEDAELRAIANKPSSTYVFYVEDYIAISKIREVMK | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title