Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. CXXC5 Antibody, Novus Biologicals™

CXXC5 Antibody, Novus Biologicals™
SDP

Catalog No. NB407327 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB407327 25 μL
NBP181675 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB407327 Supplier Novus Biologicals Supplier No. NBP18167525UL
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

CXXC5 Polyclonal specifically detects CXXC5 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen CXXC5
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias CF5, CXXC finger 5, CXXC finger 5 protein, CXXC finger protein 5, CXXC-type zinc finger protein 5, HSPC195, Putative MAPK-activating protein PM08, Putative NF-kappa-B-activating protein 102, retinoid-inducible nuclear factor, RINF, WID, WT1-induced Inhibitor of Dishevelled
Gene Symbols CXXC5
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:PDMEAVAGAEALNGQSDFPYLGAFPINPGLFIMTPAGVFLAESALHMAGLAEYPMQGELASAISSGKKKRK
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 51523
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.