Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. CYP11B1 Antibody, Novus Biologicals™

CYP11B1 Antibody, Novus Biologicals™
SDP

Catalog No. p-7108567 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP168882 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP168882 Supplier Novus Biologicals Supplier No. NBP168882
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

CYP11B1 Polyclonal specifically detects CYP11B1 in Human samples. It is validated for Western Blot.

Specifications

Antigen CYP11B1
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P15538
Gene Alias CPN1, CYPXIB1, cytochrome P450 11B1, mitochondrial, cytochrome p450 XIB1, cytochrome P450, family 11, subfamily B, polypeptide 1, cytochrome P450, subfamily XIB (steroid 11-beta-hydroxylase), polypeptide 1, Cytochrome P-450c11, Cytochrome P450C11, EC 1.14.15, EC 1.14.15.4, FHICYP11B, FLJ36771, P450C11DKFZp686B05283, S11BH, Steroid 11-beta-hydroxylase, steroid 11-beta-monooxygenase
Gene Symbols CYP11B1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to CYP11B1 (cytochrome P450, family 11, subfamily B, polypeptide 1) The peptide sequence was selected from the middle region of CYP11B1. Peptide sequence LALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWTSPK.
Molecular Weight of Antigen 55 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Lipid and Metabolism
Primary or Secondary Primary
Gene ID (Entrez) 1584
Test Specificity Rat: 79%; Equine: 79%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Rat, Equine
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.