Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CYP3A7 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$149.00 - $299.00
Specifications
| Antigen | CYP3A7 |
|---|---|
| Immunogen | Synthetic peptides corresponding to CYP3A7(cytochrome P450, family 3, subfamily A, polypeptide 7) The peptide sequence was selected from the middle region of CYP3A7. Peptide sequence KSVKQIKEGRLKETQKHRVDFLQLMIDSQNSKDSETHKALSDLELMAQSI. |
| Host Species | Rabbit |
| Primary or Secondary | Primary |
| Monoclonal or Polyclonal | Polyclonal |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
| NBP16238720 |
Novus Biologicals
NBP16238720UL |
20ul |
Each for $149.00
|
|
NBP162387 |
Novus Biologicals
NBP162387 |
100ul |
Each for $299.00
|
|
Description
CYP3A7 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.Specifications
| CYP3A7 | |
| Rabbit | |
| Polyclonal | |
| Unconjugated | |
| 1551 | |
| Purified | |
| Western Blot | |
| RUO |
| Synthetic peptides corresponding to CYP3A7(cytochrome P450, family 3, subfamily A, polypeptide 7) The peptide sequence was selected from the middle region of CYP3A7. Peptide sequence KSVKQIKEGRLKETQKHRVDFLQLMIDSQNSKDSETHKALSDLELMAQSI. | |
| Primary | |
| IgG | |
| CYPIIIA7, cytochrome P450, family 3, subfamily A, polypeptide 7, Cytochrome P450-HFLA, EC 1.14.14.1, flavoprotein-linked monooxygenase, microsomal monooxygenase, subfamily IIIA, polypeptide 7, xenobiotic monooxygenase | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| Protein A purified | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title