Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CYP3A7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$206.00 - $487.50

Specifications

Antigen	CYP3A7
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Form	Purified

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP16238720 View Documents View Product Certificates	Novus Biologicals NBP16238720UL	20 μL	Each for $206.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP162387 View Documents View Product Certificates	Novus Biologicals NBP162387	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

CYP3A7 Polyclonal specifically detects CYP3A7 in Human samples. It is validated for Western Blot.

Specifications

Antigen	CYP3A7
Classification	Polyclonal
Form	Purified
Regulatory Status	RUO
Gene Accession No.	P24462
Gene ID (Entrez)	1551
Immunogen	Synthetic peptides corresponding to CYP3A7(cytochrome P450, family 3, subfamily A, polypeptide 7) The peptide sequence was selected from the middle region of CYP3A7. Peptide sequence KSVKQIKEGRLKETQKHRVDFLQLMIDSQNSKDSETHKALSDLELMAQSI.
Primary or Secondary	Primary
Molecular Weight of Antigen	57 kDa

Applications	Western Blot
Conjugate	Unconjugated
Host Species	Rabbit
Research Discipline	Lipid and Metabolism
Gene Alias	CYPIIIA7, cytochrome P450, family 3, subfamily A, polypeptide 7, Cytochrome P450-HFLA, EC 1.14.14.1, flavoprotein-linked monooxygenase, microsomal monooxygenase, subfamily IIIA, polypeptide 7, xenobiotic monooxygenase
Gene Symbols	CYP3A7
Isotype	IgG
Purification Method	Protein A purified

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

CYP3A7 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents