Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
                
Learn More
Learn More
                                Cystatin-8 Antibody, Novus Biologicals™
 
                                
                                
                                
                                
                            
                            
                            
                                
                                    
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | Cystatin-8 | 
|---|---|
| Applications | Western Blot | 
| Classification | Polyclonal | 
| Conjugate | Unconjugated | 
| Host Species | Rabbit | 
Description
Cystatin-8 Polyclonal specifically detects Cystatin-8 in Human samples. It is validated for Western Blot.Specifications
| Cystatin-8 | |
| Polyclonal | |
| Rabbit | |
| O60676 | |
| 10047 | |
| Synthetic peptides corresponding to CST8(cystatin 8 (cystatin-related epididymal specific)) The peptide sequence was selected from the middle region of CST8. Peptide sequence LKPVNASNANVKQCLWFAMQEYNKESEDKYVFLVVKTLQAQLQVTNLLEY. | |
| Primary | 
| Western Blot | |
| Unconjugated | |
| RUO | |
| CRESCystatin-related epididymal spermatogenic protein, cystatin 8 (cystatin-related epididymal specific), cystatin-8, cystatin-related epididymal-specific | |
| CST8 | |
| IgG | 
Spot an opportunity for improvement?Share a Content Correction
            
                    Product Content Correction
                
                Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
			
            