Cytochrome P450 2B6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157978

Catalog No. NBP157978

Description

Cytochrome P450 2B6 Polyclonal specifically detects Cytochrome P450 2B6 in Human, Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: Cytochrome P450 2B6
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CPB6, CYP2B, CYP2B7, CYP2B7P, CYPIIB6cytochrome P450, subfamily IIB (phenobarbital-inducible), cytochrome P450 2B6, Cytochrome P450 IIB1, cytochrome P450, family 2, subfamily B, cytochrome P450, family 2, subfamily B, polypeptide 6, cytochrome P450, subfamily IIB (phenobarbital-inducible), polypeptide 6, EC 1.14.14.1, IIB1, P450
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Bovine: 78%; Pig: 78%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P20813
• Gene Symbols: CYP2B6
• Immunogen: Synthetic peptides corresponding to CYP2B6(cytochrome P450, family 2, subfamily B, polypeptide 6) The peptide sequence was selected from the middle region of CYP2B6. Peptide sequence QLFELFSGFLKYFPGAHRQVYKNLQEINAYIGHSVEKHRETLDPSAPKDL.
• Quantity: 100 μL
• Research Discipline: Lipid and Metabolism
• Gene ID (Entrez): 1555
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.