Cytochrome P450 2B6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP15797820UL

Catalog No. NBP15797820

Description

Cytochrome P450 2B6 Polyclonal specifically detects Cytochrome P450 2B6 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Cytochrome P450 2B6
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:2000
• Gene Accession No.: P20813
• Gene Symbols: CYP2B6
• Immunogen: Synthetic peptides corresponding to CYP2B6(cytochrome P450, family 2, subfamily B, polypeptide 6) The peptide sequence was selected from the middle region of CYP2B6. Peptide sequence QLFELFSGFLKYFPGAHRQVYKNLQEINAYIGHSVEKHRETLDPSAPKDL.
• Quantity: 20 μL
• Research Discipline: Lipid and Metabolism
• Gene ID (Entrez): 1555
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS & 2% Sucrose. with No Preservative
• Gene Alias: CPB6, CYP2B, CYP2B7, CYP2B7P, CYPIIB6cytochrome P450, subfamily IIB (phenobarbital-inducible), cytochrome P450 2B6, Cytochrome P450 IIB1, cytochrome P450, family 2, subfamily B, cytochrome P450, family 2, subfamily B, polypeptide 6, cytochrome P450, subfamily IIB (phenobarbital-inducible), polypeptide 6, EC 1.14.14.1, IIB1, P450
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Isotype: IgG