Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Cytochrome P450 2B6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | Cytochrome P450 2B6 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15797820
|
Novus Biologicals
NBP15797820UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP157978
|
Novus Biologicals
NBP157978 |
100 μL |
Each for $487.50
|
|
|||||
Description
Cytochrome P450 2B6 Polyclonal specifically detects Cytochrome P450 2B6 in Human, Mouse samples. It is validated for Western Blot.Specifications
| Cytochrome P450 2B6 | |
| Polyclonal | |
| Rabbit | |
| Lipid and Metabolism | |
| CPB6, CYP2B, CYP2B7, CYP2B7P, CYPIIB6cytochrome P450, subfamily IIB (phenobarbital-inducible), cytochrome P450 2B6, Cytochrome P450 IIB1, cytochrome P450, family 2, subfamily B, cytochrome P450, family 2, subfamily B, polypeptide 6, cytochrome P450, subfamily IIB (phenobarbital-inducible), polypeptide 6, EC 1.14.14.1, IIB1, P450 | |
| CYP2B6 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| P20813 | |
| 1555 | |
| Synthetic peptides corresponding to CYP2B6(cytochrome P450, family 2, subfamily B, polypeptide 6) The peptide sequence was selected from the middle region of CYP2B6. Peptide sequence QLFELFSGFLKYFPGAHRQVYKNLQEINAYIGHSVEKHRETLDPSAPKDL. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title