Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

DBX2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen DBX2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP179220UL
View Documents
Novus Biologicals
NBP17921120UL
20 μL
Each for $152.22
Add to cart
 
NBP179211
View Documents
Novus Biologicals
NBP179211
100 μL
Each for $436.00
Add to cart
 
Description

Description

DBX2 Polyclonal specifically detects DBX2 in Human samples. It is validated for Western Blot.
Specifications

Specifications

DBX2
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
developing brain homeobox 2, developing brain homeobox protein 2, FLJ16139, homeobox protein DBX2
DBX2
IgG
Affinity Purified
Western Blot
Unconjugated
RUO
NP_001004329
440097
Synthetic peptide directed towards the middle region of human DBX2The immunogen for this antibody is DBX2. Peptide sequence SSPRWRENSPEPSERLIQESSGAPPPEANSLQGALYLCSEEEAGSKGVLT.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit