Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DCP2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$158.00 - $487.50
Specifications
| Antigen | DCP2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15744220
|
Novus Biologicals
NBP15744220UL |
20 μL |
Each for $158.00
|
|
|||||
|
NBP157442
|
Novus Biologicals
NBP157442 |
100 μL |
Each for $487.50
|
|
|||||
Description
DCP2 Polyclonal specifically detects DCP2 in Human samples. It is validated for Western Blot.Specifications
| DCP2 | |
| Polyclonal | |
| Rabbit | |
| Q8IU60 | |
| 167227 | |
| Synthetic peptides corresponding to DCP2(DCP2 decapping enzyme homolog (S. cerevisiae)) The peptide sequence was selected from the C terminal of DCP2. Peptide sequence VEKLSRTKFRHSQQLFPDGSPGDQWVKHRQPLQQKPYNNHSEMSDLLKGK. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| DCP2 decapping enzyme homolog (S. cerevisiae), EC 3.-, FLJ33245, hDpc, mRNA-decapping enzyme 2, nudix (nucleoside diphosphate linked moiety X)-type motif 20, Nudix motif 20, NUDT20Nucleoside diphosphate-linked moiety X motif 20 | |
| DCP2 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title