Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DCP2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | DCP2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15744220
|
Novus Biologicals
NBP15744220UL |
20 μL |
Each for $152.22
|
|
NBP157442
|
Novus Biologicals
NBP157442 |
100 μL |
Each for $436.00
|
|
Description
DCP2 Polyclonal specifically detects DCP2 in Human samples. It is validated for Western Blot.Specifications
| DCP2 | |
| Polyclonal | |
| Rabbit | |
| Q8IU60 | |
| 167227 | |
| Synthetic peptides corresponding to DCP2(DCP2 decapping enzyme homolog (S. cerevisiae)) The peptide sequence was selected from the C terminal of DCP2. Peptide sequence VEKLSRTKFRHSQQLFPDGSPGDQWVKHRQPLQQKPYNNHSEMSDLLKGK. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| DCP2 decapping enzyme homolog (S. cerevisiae), EC 3.-, FLJ33245, hDpc, mRNA-decapping enzyme 2, nudix (nucleoside diphosphate linked moiety X)-type motif 20, Nudix motif 20, NUDT20Nucleoside diphosphate-linked moiety X motif 20 | |
| DCP2 | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title