Derlin 1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB431354	Novus Biologicals NBP18802325UL	25 μL
NBP188023	Novus Biologicals NBP188023	0.1 mL

Description

Derlin 1 Polyclonal specifically detects Derlin 1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Derlin 1
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: DER-1, DER1Degradation in endoplasmic reticulum protein 1, Der1-like domain family, member 1, Der1-like protein 1, derlin-1, DERtrin-1, FLJ13784, FLJ42092, MGC3067, PRO2577
• Gene Symbols: DERL1
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: ER Markers, Immunology, Lipid and Metabolism, Protein Turnover, Signal Transduction, Unfolded Protein Response
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 79139
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:LMFRYPMDLGGRNFLSTPQFLYRWLPSRRGGVSGFGVPPASMRRAADQNGGGGRHNWGQGFRLGDQ
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only