Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DNER Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17941520UL
Description
DNER Polyclonal specifically detects DNER in Human samples. It is validated for Western Blot.Specifications
DNER | |
Polyclonal | |
Western Blot 1:1000 | |
AAH24766 | |
DNER | |
Synthetic peptide directed towards the middle region of human DNERThe immunogen for this antibody is DNER. Peptide sequence DACQRKPCQNNASCIDANEKQDGSNFTCVCLPGYTGELCQSKIDYCILDP. | |
20 μL | |
Growth and Development, Neuronal Cell Markers | |
92737 | |
Store at -20C. Avoid freeze-thaw cycles. | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
bet, delta and Notch-like epidermal growth factor-related receptor, delta/notch-like EGF repeat containing, delta-notch-like EGF repeat-containing transmembrane, H_NH0150O02.1, UNQ26, WUGSC:H_NH0150O02.1 | |
Rabbit | |
Protein A purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction