DUSP22 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB433195	Novus Biologicals NBP18307825UL	25 μL
NBP183078	Novus Biologicals NBP183078	0.1 mL

Description

DUSP22 Polyclonal specifically detects DUSP22 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: DUSP22
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: dual specificity phosphatase 22, dual specificity protein phosphatase 22, EC 3.1.3.16, EC 3.1.3.48, FLJ35864, homolog of mouse dual specificity phosphatase LMW-DSP2, JKAP, JNK-stimulating phosphatase 1, JSP-1, JSP1JNK-stimulatory phosphatase-1, LMWDSP2, LMW-DSP2, Low molecular weight dual specificity phosphatase 2, Mitogen-activated protein kinase phosphatase x, MKP-x, MKPXMAP kinase phosphatase x, VHX
• Gene Symbols: DUSP22
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500-1:1000
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: GPCR, MAP Kinase Signaling, Protein Phosphatase
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 56940
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:GVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFW
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only