Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. DYNLT3 Antibody, Novus Biologicals™

DYNLT3 Antibody, Novus Biologicals™
SDP

Catalog No. p-200048161 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
25ul
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB407440 25ul
NBP180698 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB407440 Supplier Novus Biologicals Supplier No. NBP18069825UL
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

DYNLT3 Polyclonal specifically detects DYNLT3 in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen DYNLT3
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. P51808
Gene Alias dynein, light chain, Tctex-type 3, Protein 91/23, RP3, T-complex-associated testis-expressed 1-like, t-complex-associated-testis-expressed 1-like, TCTE1Ldynein light chain Tctex-type 3, TCTE1XL, TCTEX1L
Gene Symbols DYNLT3
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:DEVGFNAEEAHNIVKECVDGVLGGEDYNHNNINQWTASIVEQSLTHLVKLGKAYKYIVTCAVVQKSAYGFHTASSCFWDTTSDGTCTVRWE
Molecular Weight of Antigen 13 kDa
Purification Method Affinity Purified
Quantity 25ul
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 6990
Test Specificity Specificity of human DYNLT3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Rat, Mouse
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.