Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ECHDC3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17930220UL
Description
ECHDC3 Polyclonal specifically detects ECHDC3 in Human samples. It is validated for Western Blot.Specifications
ECHDC3 | |
Polyclonal | |
Western Blot 1:1000 | |
EAW86340 | |
ECHDC3 | |
Synthetic peptide directed towards the N terminal of human ECHDC3The immunogen for this antibody is ECHDC3. Peptide sequence SLAMLKSLQSDILHDADSNDLKVIIISAEGPVFSSGHDLKELTEEQGRDY. | |
20 μL | |
Primary | |
Human | |
Purified |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
enoyl CoA hydratase domain containing 3, enoyl Coenzyme A hydratase domain containing 3, FLJ20909, mitochondrial | |
Rabbit | |
Protein A purified | |
RUO | |
79746 | |
Store at -20C. Avoid freeze-thaw cycles. | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction