Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Ephrin-A1 Antibody (CL6501), Novus Biologicals™

Mouse Monoclonal Antibody

$382.00 - $610.00

Specifications

Antigen	Ephrin-A1
Clone	CL6501
Applications	Western Blot
Classification	Monoclonal
Conjugate	Unconjugated

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NB392753 View Documents View Product Certificates	Novus Biologicals NBP27649725UL	25 μL	Each for $382.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP276497 View Documents View Product Certificates	Novus Biologicals NBP276497	100 μL	Each for $610.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

Ephrin-A1 Monoclonal specifically detects Ephrin-A1 in Human samples. It is validated for Western Blot.

Specifications

Antigen	Ephrin-A1
Applications	Western Blot
Conjugate	Unconjugated
Target Species	Human
Gene Alias	ECKLG, EFL1, EPH-related receptor tyrosine kinase ligand 1, ephrin-A1, EPLG1TNF alpha-induced protein 4, Immediate early response protein B61, LERK1LERK-1, ligand of eph-related kinase 1, TNFAIP4B61, Tumor necrosis factor alpha-induced protein 4, tumor necrosis factor, alpha-induced protein 4
Gene Symbols	EFNA1
Isotype	IgG1
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Clone	CL6501
Classification	Monoclonal
Host Species	Mouse
Formulation	PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide
Gene ID (Entrez)	1942
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids: RHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHGPEK
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

Ephrin-A1 Antibody (CL6501), Novus Biologicals™

Specifications

Description

Specifications

Documents