Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Evx1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP179702
Description
Evx1 Polyclonal specifically detects Evx1 in Human samples. It is validated for Western Blot.Specifications
| Evx1 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| eve, even-skipped homeo box homolog 1, eve, even-skipped homeobox homolog 1, eve, even-skipped homeobox homolog 1 (Drosophila), even-skipped homeo box 1 (homolog of Drosophila), even-skipped homeobox 1, EVX-1, homeobox even-skipped homolog protein 1 | |
| Rabbit | |
| 42 kDa | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Pig: 86%; Rat: 86%; Guinea pig: 86%; Mouse: 79%; Bovine: 75%. | |
| Human, Mouse, Rat, Bovine, Equine, Guinea Pig | |
| IgG |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| NP_001980 | |
| EVX1 | |
| Synthetic peptide directed towards the middle region of human EVX1The immunogen for this antibody is EVX1. Peptide sequence GSGSEALVGSPNGGSETPKSNGGSGGGGSQGTLACSASDQMRRYRTAFTR. | |
| Affinity purified | |
| RUO | |
| 2128 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction