Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
EZFIT/ZNF71 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP180358
Description
EZFIT/ZNF71 Polyclonal specifically detects EZFIT/ZNF71 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| EZFIT/ZNF71 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| endothelial zinc finger protein induced by tumor necrosis factor alpha, Kruppel-related zinc finger protein, zinc finger protein 71 (Cos26), zinc finger protein 71EZFITCos26 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 58491 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500 | |
| NP_067039 | |
| ZNF71 | |
| Synthetic peptide directed towards the middle region of human ZNF71. Peptide sequence RCGQCGKSFIKNSSLTVHQRIHTGEKPYRCGECGKTFSRNTNLTRHLRIH. | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Equine: 100%; Human: 100%. | |
| Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction