Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
EZFIT/ZNF71 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Specifications
Antigen | EZFIT/ZNF71 |
---|---|
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP18035820
|
Novus Biologicals
NBP18035820UL |
20 μL |
Each for $152.22
|
N/A |
NBP180358
|
Novus Biologicals
NBP180358 |
100 μL |
Each for $436.00
|
N/A |
Description
EZFIT/ZNF71 Polyclonal specifically detects EZFIT/ZNF71 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
EZFIT/ZNF71 | |
Polyclonal | |
Rabbit | |
NP_067039 | |
58491 | |
Synthetic peptide directed towards the middle region of human ZNF71. Peptide sequence RCGQCGKSFIKNSSLTVHQRIHTGEKPYRCGECGKTFSRNTNLTRHLRIH. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
endothelial zinc finger protein induced by tumor necrosis factor alpha, Kruppel-related zinc finger protein, zinc finger protein 71 (Cos26), zinc finger protein 71EZFITCos26 | |
ZNF71 | |
IgG | |
Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title