Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FAM132B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications

$382.00 - $646.00

Specifications

Antigen	FAM132B
Applications	Western Blot, Immunocytochemistry, Immunofluorescence, Immunoprecipitation
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP257732 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP257732	100 μL	Each for $646.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NB393805 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP25773225UL	25 μL	Each for $382.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

FAM132B Polyclonal specifically detects FAM132B in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence, Immunoprecipitation.

Specifications

Antigen	FAM132B
Classification	Polyclonal
Host Species	Rabbit
Target Species	Human
Gene ID (Entrez)	151176
Immunogen	This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EPTAERAHSVDPRDAWMLFVRQSDKGVNGKKRSRGKAKKLKFGLPGP
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Applications	Western Blot, Immunocytochemistry, Immunofluorescence, Immunoprecipitation
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	C1qTNF15, Complement C1q Tumor Necrosis Factor-Related Protein 15, CTRP15, ERFE, Erythroferrone, Family With Sequence Similarity 132, Member B, Myonectin, Protein FAM132B
Gene Symbols	FAM132B
Isotype	IgG
Purification Method	Affinity Purified

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

FAM132B Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents