Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FAM190A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | FAM190A |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
FAM190A Polyclonal specifically detects FAM190A in Human samples. It is validated for Western Blot.Specifications
FAM190A | |
Polyclonal | |
Rabbit | |
Q9C0I3-2 | |
401145 | |
Synthetic peptides corresponding to MGC48628(similar to KIAA1680 protein) The peptide sequence was selected from the N terminal of MGC48628. Peptide sequence HHKKGSEPKQEPTNQNLSISNGAQPGHSNMQKLSLEEHIKTRGRHSVGFS. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
family with sequence similarity 190, member A, KIAA1680 protein, KIAA1680MGC48628 | |
CCSER1 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title