Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FAM46D Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$493.10
Specifications
| Antigen | FAM46D |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
FAM46D Polyclonal specifically detects FAM46D in Human samples. It is validated for Western Blot.Specifications
| FAM46D | |
| Polyclonal | |
| Rabbit | |
| Q8NEK8 | |
| 169966 | |
| Synthetic peptides corresponding to FAM46D(family with sequence similarity 46, member D) The peptide sequence was selected from the middle region of FAM46D. Peptide sequence LPNTQKVTCFYQPAPYFAAEARYPIYVIPEPPPVSFQPYHPLHFRGSNGM. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| cancer/testis antigen 112, CT1.26, CT112, family with sequence similarity 46, member D, hypothetical protein LOC169966, MGC26999 | |
| FAM46D | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title