Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FAM46D Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | FAM46D |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
FAM46D Polyclonal specifically detects FAM46D in Human samples. It is validated for Western Blot.Specifications
FAM46D | |
Polyclonal | |
Rabbit | |
Q8NEK8 | |
169966 | |
Synthetic peptides corresponding to FAM46D(family with sequence similarity 46, member D) The peptide sequence was selected from the middle region of FAM46D. Peptide sequence LPNTQKVTCFYQPAPYFAAEARYPIYVIPEPPPVSFQPYHPLHFRGSNGM. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
cancer/testis antigen 112, CT1.26, CT112, family with sequence similarity 46, member D, hypothetical protein LOC169966, MGC26999 | |
FAM46D | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title