FBXL5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP154917

Catalog No. NBP154917

Description

FBXL5 Polyclonal specifically detects FBXL5 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: FBXL5
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: FBXL5
• Immunogen: Synthetic peptides corresponding to FBXL5(F-box and leucine-rich repeat protein 5) The peptide sequence was selected from the middle region of FBXL5. Peptide sequence LRTMSSLPESSAMCRKAARTRLPRGKDLIYFGSEKSDQETGRVLLFLSLS.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 26234
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: FBL5FBL4F-box protein FBL5, F-box and leucine-rich repeat protein 5p45SKP2-like protein, F-box protein FBL4/FBL5, FLR1F-box/LRR-repeat protein 5
• Host Species: Rabbit
• Molecular Weight of Antigen: 63 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.