Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FBXL5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15491720UL
Description
FBXL5 Polyclonal specifically detects FBXL5 in Human samples. It is validated for Western Blot.Specifications
FBXL5 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
FBL5FBL4F-box protein FBL5, F-box and leucine-rich repeat protein 5p45SKP2-like protein, F-box protein FBL4/FBL5, FLR1F-box/LRR-repeat protein 5 | |
Rabbit | |
63 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
FBXL5 | |
Synthetic peptides corresponding to FBXL5(F-box and leucine-rich repeat protein 5) The peptide sequence was selected from the middle region of FBXL5. Peptide sequence LRTMSSLPESSAMCRKAARTRLPRGKDLIYFGSEKSDQETGRVLLFLSLS. | |
Affinity Purified | |
RUO | |
26234 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction