Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. FBXL5 Antibody, Novus Biologicals™

FBXL5 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15491720 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15491720 20 μL
NBP154917 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15491720 Supplier Novus Biologicals Supplier No. NBP15491720UL

Description

Rabbit Polyclonal Antibody

FBXL5 Polyclonal specifically detects FBXL5 in Human samples. It is validated for Western Blot.

Specifications

Antigen FBXL5
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS & 2% Sucrose. with No Preservative
Gene Alias FBL5FBL4F-box protein FBL5, F-box and leucine-rich repeat protein 5p45SKP2-like protein, F-box protein FBL4/FBL5, FLR1F-box/LRR-repeat protein 5
Gene Symbols FBXL5
Host Species Rabbit
Immunogen Synthetic peptides corresponding to FBXL5(F-box and leucine-rich repeat protein 5) The peptide sequence was selected from the middle region of FBXL5. Peptide sequence LRTMSSLPESSAMCRKAARTRLPRGKDLIYFGSEKSDQETGRVLLFLSLS.
Molecular Weight of Antigen 63 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 26234
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.