Learn More
Description
Specifications
Specifications
| Antigen | FBXL5 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:100-1:2000 |
| Formulation | PBS & 2% Sucrose. with No Preservative |
| Gene Alias | FBL5FBL4F-box protein FBL5, F-box and leucine-rich repeat protein 5p45SKP2-like protein, F-box protein FBL4/FBL5, FLR1F-box/LRR-repeat protein 5 |
| Gene Symbols | FBXL5 |
| Host Species | Rabbit |
| Immunogen | Synthetic peptides corresponding to FBXL5(F-box and leucine-rich repeat protein 5) The peptide sequence was selected from the middle region of FBXL5. Peptide sequence LRTMSSLPESSAMCRKAARTRLPRGKDLIYFGSEKSDQETGRVLLFLSLS. |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
