Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. FBXW12 Antibody, Novus Biologicals™

FBXW12 Antibody, Novus Biologicals™
SDP

Catalog No. p-200040693 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB437424 25 μL
NBP230761 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB437424 Supplier Novus Biologicals Supplier No. NBP23076125UL
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

FBXW12 Polyclonal specifically detects FBXW12 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen FBXW12
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q6X9E4
Gene Alias F-box and WD repeat domain containing 12, F-box and WD-40 domain-containing protein 12, F-box- and WD40-repeat-containing protein, F-box only protein 35MGC120386, F-box/WD repeat-containing protein 12, Fbw12, FBW12MGC120387, FBXO12FBXO35F-box and WD-40 domain protein 12, MGC120385
Gene Symbols FBXW12
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: PQVFLTESLLRPSEGSVPLSTFLPHKLCASACWTPKVKNRITLMSQSSTGKKTEFITFDLTTKKTGGQTVIQAYEIASFQVAAHLKCPIWMGA
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 285231
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.