Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FEZF1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | FEZF1 |
---|---|
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Regulatory Status | RUO |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP191367
![]() |
Novus Biologicals
NBP191367 |
100 μL |
Each for $487.50
|
|
|||||
NBP19136720
![]() |
Novus Biologicals
NBP19136720UL |
20 μL | N/A | N/A | N/A | ||||
Description
FEZF1 Polyclonal specifically detects FEZF1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
FEZF1 | |
Unconjugated | |
RUO | |
FEZ, FEZ family zinc finger 1, zinc finger protein 312B, ZNF312B | |
FEZF1 | |
IgG |
Polyclonal | |
Rabbit | |
NP_001019784 | |
389549 | |
Synthetic peptide directed towards the C terminal of human FEZF1. Peptide sequence CPTCGKGFCRNFDLKKHVRKLHDSSLGLARTPAGEPGTEPPPPLPQQPPM. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title