Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Ficolin-3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP158024
Description
Ficolin-3 Polyclonal specifically detects Ficolin-3 in Human samples. It is validated for Western Blot.Specifications
Ficolin-3 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
Collagen/fibrinogen domain-containing lectin 3 p35, Collagen/fibrinogen domain-containing protein 3, FCNHficolin 3, ficolin (collagen/fibrinogen domain containing) 3 (Hakata antigen), ficolin (collagen/fibrinogen domain-containing) 3 (Hakata antigen), ficolin-3, HAKA1MGC22543, Hakata antigen, H-ficolin | |
Rabbit | |
Affinity purified | |
RUO | |
8547 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
O75636 | |
FCN3 | |
Synthetic peptides corresponding to FCN3(ficolin (collagen/fibrinogen domain containing) 3 (Hakata antigen)) The peptide sequence was selected from the N terminal of FCN3. Peptide sequence LEASKVVLLPSCPGAPGSPGEKGAPGPQGPPGPPGKMGPKGEPGDPVNLL | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Equine: 100%; Human: 100%. | |
Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction