Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Ficolin-3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15802420UL
Description
Ficolin-3 Polyclonal specifically detects Ficolin-3 in Human samples. It is validated for Western Blot.Specifications
Ficolin-3 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
O75636 | |
FCN3 | |
Synthetic peptides corresponding to FCN3(ficolin (collagen/fibrinogen domain containing) 3 (Hakata antigen)) The peptide sequence was selected from the N terminal of FCN3. Peptide sequence LEASKVVLLPSCPGAPGSPGEKGAPGPQGPPGPPGKMGPKGEPGDPVNLL | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
Collagen/fibrinogen domain-containing lectin 3 p35, Collagen/fibrinogen domain-containing protein 3, FCNHficolin 3, ficolin (collagen/fibrinogen domain containing) 3 (Hakata antigen), ficolin (collagen/fibrinogen domain-containing) 3 (Hakata antigen), ficolin-3, HAKA1MGC22543, Hakata antigen, H-ficolin | |
Rabbit | |
Affinity Purified | |
RUO | |
8547 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction