Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Ficolin-3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$492.89
Specifications
| Antigen | Ficolin-3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP158024
|
Novus Biologicals
NBP158024 |
100 μL |
Each for $492.89
|
|
|||||
|
NBP15802420
|
Novus Biologicals
NBP15802420UL |
20 μL | N/A | N/A | N/A | ||||
Description
Ficolin-3 Polyclonal specifically detects Ficolin-3 in Human samples. It is validated for Western Blot.Specifications
| Ficolin-3 | |
| Polyclonal | |
| Rabbit | |
| O75636 | |
| 8547 | |
| Synthetic peptides corresponding to FCN3(ficolin (collagen/fibrinogen domain containing) 3 (Hakata antigen)) The peptide sequence was selected from the N terminal of FCN3. Peptide sequence LEASKVVLLPSCPGAPGSPGEKGAPGPQGPPGPPGKMGPKGEPGDPVNLL | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Collagen/fibrinogen domain-containing lectin 3 p35, Collagen/fibrinogen domain-containing protein 3, FCNHficolin 3, ficolin (collagen/fibrinogen domain containing) 3 (Hakata antigen), ficolin (collagen/fibrinogen domain-containing) 3 (Hakata antigen), ficolin-3, HAKA1MGC22543, Hakata antigen, H-ficolin | |
| FCN3 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title