Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Ficolin-3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | Ficolin-3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15802420
|
Novus Biologicals
NBP15802420UL |
20 μL |
Each for $152.22
|
|
NBP158024
|
Novus Biologicals
NBP158024 |
100 μL |
Each for $436.00
|
|
Description
Ficolin-3 Polyclonal specifically detects Ficolin-3 in Human samples. It is validated for Western Blot.Specifications
| Ficolin-3 | |
| Polyclonal | |
| Rabbit | |
| O75636 | |
| 8547 | |
| Synthetic peptides corresponding to FCN3(ficolin (collagen/fibrinogen domain containing) 3 (Hakata antigen)) The peptide sequence was selected from the N terminal of FCN3. Peptide sequence LEASKVVLLPSCPGAPGSPGEKGAPGPQGPPGPPGKMGPKGEPGDPVNLL | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Collagen/fibrinogen domain-containing lectin 3 p35, Collagen/fibrinogen domain-containing protein 3, FCNHficolin 3, ficolin (collagen/fibrinogen domain containing) 3 (Hakata antigen), ficolin (collagen/fibrinogen domain-containing) 3 (Hakata antigen), ficolin-3, HAKA1MGC22543, Hakata antigen, H-ficolin | |
| FCN3 | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title