Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FLJ14154 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | FLJ14154 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
FLJ14154 Polyclonal specifically detects FLJ14154 in Human samples. It is validated for Western Blot.Specifications
FLJ14154 | |
Polyclonal | |
Rabbit | |
NP_001077070 | |
79903 | |
Synthetic peptide directed towards the middle region of human NAT15. Peptide sequence DYIQHLGSALASLSPCSIPHRVYRQAHSLLCSFLPWSGISSKSGIEYSRT. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
EC 2.3.1, EC 2.3.1.-, FLJ11693, FLJ14154, N-acetyltransferase 15, N-acetyltransferase 15 (GCN5-related, putative) | |
NAA60 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title