Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Fucosyltransferase 3/FUT3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
| Antigen | Blood Group Lewis b |
|---|---|
| Dilution | Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Applications | Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
Fucosyltransferase 3/FUT3 Polyclonal specifically detects Fucosyltransferase 3/FUT3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Blood Group Lewis b | |
| Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 2525 | |
| This antibody was developed against a Recombinant Protein corresponding to amino acids:KDLARYLQELDKDHARYLSYFRWRETLRPRSFSWAL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| alpha-(1,3/1,4)-fucosyltransferase, Blood group Lewis alpha-4-fucosyltransferase, CD174, EC 2.4.1, EC 2.4.1.65, FT3B, Fucosyltransferase 3, fucosyltransferase 3 (galactoside 3(4)-L-fucosyltransferase, Lewis blood group), Fucosyltransferase III, FucT-III, galactoside 3(4)-L-fucosyltransferase, LEfucosyltransferase 3 (galactoside 3(4)-L-fucosyltransferase, Lewis blood groupincluded), Les, Lewis FT, MGC131739 | |
| FUT3 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title